Download Mussel Royalty-Free Stock Video Clips

Royalty-free Stock Footage Clips, Motion Backgrounds, and Templates

All
Video

319 results found for mussel

musselsseafoodoystersprawnsshellfishshrimpssquidclams
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

"mussel"

California Mussel shells growing on beach shore 4k

Seafood barbecue, delicious stall food selling at thai beach

Cooked mussels macro. Clams with vegetables and rosemary.

Hand with tongs, seafood pasta. Fettuccine, shrimps and mussels.

Mossy sea plants and shell mussel colonies on wet rock by the sea

mussel farming offshore in the south pacific ocean. aerial view with forward motion.

Clams and Mussel Shells on the Sandy Beach With Slider

Freshly catch mussels Served on white plate

Authentic shot of young woman hands are washing fresh clams with a water before cooking in the kit

Freshly catch mussels Served in white bowl. Seafood restaurant dish

Tiger Cowrie Seashell on a black sand 4K

Strombidae Seashell on a black sand background HD

Close up view of person Preparing Traditional Spanish Paella 2

Young woman eating sea Paella, traditional Valencian rice dish. Traditional Spanish paella with shrimps and mussels served in a cafe.

Cooked sea snail in rotation

Woman cleans mussels, prunes, prepares for sale

Close-up shot of spoon in delicious dish with mussels. Mediterranean cuisine

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid

Sea pearl oyster shell on a black sand HD

NEW

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid

Stuffed mussels sold on the streets in Turkey

Cassis Cornuta Shell on the sand underwater 4K

Chef Cooking traditional Spanish Paella on a stove from mussels, shrimp, squid, food festival in Barcelona Spain.

Chef Cooking traditional Spanish Paella on a stove, food festival in Barcelona, Spain.

Babylonia Areolata shell on a black sand background HD

Cassis Cornuta Shell on the sand underwater 4K

Top view of female hand opening cover of big deep wok pan with steaming seafood, boiling and vapor cooked mussels with herbs and spices, healthy protein diet with fresh ingridients

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid

CU TU R/F Man working in Chinese Medicine shop / Hong Kong

Casual Kids Eating Seafood Mussels For Lunch During Summer Day outdoors

Turbinidae shell on a black sand background 4K

Bathytoma Prodicia shell on a black sand background HD

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid

Fresh mussels in a plate

Chef Cooking traditional Spanish Paella on a stove from mussels, shrimp, squid, food festival in Barcelona, Spain

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid

Aerial view of Mussel Farms in serene bay with floating platforms and coastal mountains, Nigran, Spain.

Salt Water Pacific Ocean Mussels At Low Tide

Seagull walks along coastline - unincorporated California town of Mussel Shoals

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid

A close-up view of a Conch Seashell resting on a rock against the backdrop of the ocean horizon at sunset.

The Process of Growing Pearls. Cultured Plankton in Bags on the Shelves of an Oyster Farm. Pearls and Sea Concept

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid

Cooked mussels in a pot. Seafood, toasts and lemon.

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid

Chef Cooking traditional Spanish Paella on a stove, food festival in barcelona spain. Chef cooking food on fire from mussels, shrimp, squid